PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010930410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 26951.3 Da    PI: 8.5779
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010930410.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.88.9e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+iifs +g+lyeys+
  XP_010930410.1  9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIIFSGRGRLYEYSN 59
                    79***********************************************95 PP

2K-box111.49.2e-37821748100
           K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       + + ++++qqe+akL+ +i++Lq+ +Rhl+G+ L+sLs+keL+qLe++Le+++++iRskK+ell+++ie++q++e elq++n++Lr+k++e
  XP_010930410.1  82 IIDVNSQQYYQQESAKLRHQIQTLQNANRHLMGDALSSLSVKELKQLENRLERGITRIRSKKHELLFSEIEYMQRREAELQNDNMCLRAKIAE 174
                     3677889***********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.683161IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-32273IPR002100Transcription factor, MADS-box
CDDcd002651.71E-45278No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-32323IPR002100Transcription factor, MADS-box
PfamPF003196.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-323859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-2885172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.5888178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEIALIIFSG RGRLYEYSNN  60
SIKSTIERYK NACADSSNSG AIIDVNSQQY YQQESAKLRH QIQTLQNANR HLMGDALSSL  120
SVKELKQLEN RLERGITRIR SKKHELLFSE IEYMQRREAE LQNDNMCLRA KIAENEQAAL  180
QVSIAQEGPQ FDALPAFDSR NYYHVNLLEA ATHYSHQQDQ TALHLGYEAR SDHAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P9e-21169169Myocyte-specific enhancer factor 2B
1tqe_Q9e-21169169Myocyte-specific enhancer factor 2B
1tqe_R9e-21169169Myocyte-specific enhancer factor 2B
1tqe_S9e-21169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010930410.11e-174PREDICTED: MADS-box transcription factor 21-like isoform X1
SwissprotQ8RU311e-108MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLQ5KT551e-149Q5KT55_9ASPA; MADS-box transcription factor
STRINGGSMUA_Achr5P16870_0011e-142(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-107MIKC_MADS family protein